PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma7g01530.1
Common NameZOSMA_7G01530
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family MIKC_MADS
Protein Properties Length: 247aa    MW: 28320 Da    PI: 8.6951
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma7g01530.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.21.6e-31959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    kri+nk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifss+gklye++s
  Zosma7g01530.1  9 KRIDNKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFCS 59
                    79***********************************************96 PP

2K-box97.91.5e-32801737100
           K-box   7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                     +++++++ +s+qqe+ kLk+++e+Lqr+qR+llGedL+sLs ++L++Le+qL+ sl++iRs +++++l+q+++lqk+e++l e+nkaLr++lee
  Zosma7g01530.1  80 TNVQTREIQSSQQEYLKLKARVESLQRTQRNLLGEDLGSLSSRDLENLERQLDASLRQIRSIRTQYMLDQLSDLQKQEQALCEANKALRRRLEE 173
                     4578999***********************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.884161IPR002100Transcription factor, MADS-box
SMARTSM004322.5E-41160IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.27E-33281IPR002100Transcription factor, MADS-box
CDDcd002658.95E-45275No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-32323IPR002100Transcription factor, MADS-box
PfamPF003199.4E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-323859IPR002100Transcription factor, MADS-box
PfamPF014868.1E-2683171IPR002487Transcription factor, K-box
PROSITE profilePS5129714.99987177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0048481Biological Processplant ovule development
GO:0048833Biological Processspecification of floral organ number
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MGRGRVELKR IDNKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSS RGKLYEFCSS  60
PSMLKTLERY QKCNYVAPET NVQTREIQSS QQEYLKLKAR VESLQRTQRN LLGEDLGSLS  120
SRDLENLERQ LDASLRQIRS IRTQYMLDQL SDLQKQEQAL CEANKALRRR LEETTHPSQQ  180
QVWESEAHAM AYSRQQQSQQ QHHHQSDAFF HPLDCEPTLQ IGYHPEQITV AASGPSVGGY  240
VPGWLG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A3e-37751711101Developmental protein SEPALLATA 3
4ox0_B3e-37751711101Developmental protein SEPALLATA 3
4ox0_C3e-37751711101Developmental protein SEPALLATA 3
4ox0_D3e-37751711101Developmental protein SEPALLATA 3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00605ChIP-seqTransfer from AT1G24260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4741850.0AB474185.1 Zostera japonica ZjMADS1 mRNA for putative MADS box protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008801852.11e-139PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform X3
SwissprotQ386941e-126AGL9_ARADE; Agamous-like MADS-box protein AGL9 homolog
TrEMBLA0A0K9NPY80.0A0A0K9NPY8_Z
STRINGGSMUA_Achr9P01370_0011e-134(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34833469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.21e-108MIKC_MADS family protein